accessibility menu, dialog, popup

UserName
Viewing profile as user:

Primary Antibodies

Primary antibodies are immunoglobulins that recognize and bind to a specific antigen of interest with high affinity and specificity to purify, detect, and measure that antigen. Includes antibody pairs for specific biochemical applications.
All Primary Antibodies (1,707,212)
Primary Antibody Matched Pairs (7,079)
Protein Interaction Antibody Pairs (1,422)
Protein Phosphorylation Antibody Pairs (74)

Filtered Search Results

Products from some of our suppliers do not display in filtered search results. Please clear all filters to see these products.

Narrow Results

Narrow Results

category

special offers

  • (4)
  • (191,788)

brands

  • (1)
  • (1)
  • (29)
  • (2)
  • (2)
  • (973)
  • (67,056)
  • (14,167)
  • (44)
  • (6)
  • (59,913)
  • (1)
  • (110)
  • (266)
  • (2)
  • (1,312)
  • (578)
  • (2)
  • (1)
  • (11)
  • (1)
  • (1)
  • (24)
  • (1)
  • (4)
  • (4)
  • (1)
  • (13)
  • (1)
  • (1)
  • (2)
  • (24)
  • (3)
  • (4)
  • (2)
  • (1)
  • (10,632)
  • (398)
  • (1)
  • (12)
  • (1)
  • (8)
  • (3)
  • (2)
  • (1)
  • (1)
  • (190)
  • (60)
  • (1)
  • (6)
  • (1)
  • (64)
  • (3)
  • (15)
  • (1)
  • (12)
  • (2)
  • (1)
  • (77)
  • (5)
  • (18)
  • (20)
  • (1)
  • (14,088)
  • (2)
  • (1)
  • (1)
  • (31,127)
  • (84)
  • (470)
  • (2)
  • (1)
  • (11,572)
  • (1)
  • (1)
  • (52)
  • (3,054)
  • (6)
  • (470)
  • (105)
  • (22,741)
  • (1)
  • (4,434)
  • (1)
  • (1)
  • (1)
  • (1)
  • (16,786)
  • (1)
  • (76)
  • (18,951)
  • (139)
  • (203)
  • (3)
  • (2)
  • (62)
  • (1)
  • (1)
  • (2)
  • (28)
  • (5)
  • (1)
  • (3)
  • (10)
  • (415)
  • (2)
  • (13,814)
  • (30)
  • (1)
  • (2)
  • (45)
  • (43)
  • (14,698)
  • (1)
  • (2)
  • (8)
  • (6)
  • (2)
  • (20)
  • (2)
  • (2)
  • (55)
  • (1)
  • (2)
  • (12)
  • (20)
  • (1)
  • (34)
  • (2)
  • (1)
  • (41)
  • (2)
  • (1)
  • (62)
  • (53)
  • (487)
  • (56)
  • (10)
  • (3)
  • (80)
  • (12)
  • (11)
  • (1,198)
  • (8)
  • (9)
  • (2)
  • (20)
  • (11)
  • (1)
  • (25)
  • (3)
  • (1)
  • (3)
  • (5)
  • (2)
  • (59)
  • (95)
  • (1)
  • (1)
  • (171)
  • (212)
  • (4)
  • (127)
  • (2)
  • (1)
  • (694)
  • (13)
  • (915)
  • (1)
  • (120)
  • (2,105)
  • (116)
  • (2,514)
  • (1)
  • (12)
  • (1)
  • (1)
  • (978)
  • (1)
  • (1)
  • (1)
  • (2)
  • (6)
  • (123)
  • (1)
  • (3)
  • (2)
  • (3)
  • (1)
  • (1)
  • (8)
  • (1)
  • (302)
  • (1)
  • (1,822)
  • (2)
  • (1)
  • (1,791)
  • (3)
  • (1)
  • (1)
  • (1)
  • (1)
  • (14)
  • (6)
  • (17)
  • (1)
  • (24)
  • (11)
  • (13)
  • (2)
  • (1)
  • (2)
  • (2)
  • (143)
  • (33)
  • (1)
  • (41)
  • (1)
  • (19)
  • (3)
  • (4)
  • (1)
  • (1)
  • (5)
  • (1)
  • (2)
  • (154,226)
  • (54)
  • (2)
  • (3)
  • (3)
  • (133)
  • (1)
  • (1)
  • (11)
  • (1)
  • (118)
  • (1)
  • (2)
  • (4)
  • (198)
  • (1,162)
  • (10)
  • (2)
  • (10)
  • (8)
  • (2)
  • (38)
  • (1)
  • (1)
  • (1)
  • (112)
  • (12,119)
  • (680)
  • (167)
  • (1)
  • (6)
  • (1)
  • (8,397)
  • (1)
  • (3)
  • (16)
  • (4)
  • (137)
  • (31)
  • (116)
  • (1)
  • (3)
  • (8)
  • (6)
  • (9)
  • (3)
  • (2)
  • (1)
  • (1)
  • (1)
  • (2)
  • (2)
  • (1)
  • (1,033,387)
  • (1)
  • (13)
  • (1)
  • (2)
  • (30,486)
  • (13)
  • (1)
  • (32)
  • (1)
  • (1)
  • (6)
  • (79)
  • (1)
  • (1)
  • (11)
  • (7)
  • (1)
  • (2)
  • (1)
  • (1)
  • (1)
  • (2)
  • (23)
  • (35,349)
  • (2)
  • (1)
  • (9)
  • (12,199)
  • (1)
  • (1)
  • (1)
  • (1)
  • (1)
  • (41)
  • (7)
  • (57)
  • (15)
  • (60,251)
  • (1)
  • (5)
  • (17)
  • (4)
  • (1)
  • (30)
  • (549)
  • (1)
  • (12)
  • (2,475)
  • (2)
  • (1)
  • (4)
  • (2)
  • (2)
  • (438)
  • (1)
  • (8)
  • (4)
  • (1)
  • (1)
  • (4)
  • (1)
  • (1,453)
  • (136)
  • (1)
  • (1)
  • (1)
  • (557)
  • (26)
  • (19,477)
  • (1)
  • (6)
  • (1)
  • (1)
  • (1,796)
  • (2)
  • (3)
  • (3)
  • (826)
  • (2)
  • (1)
  • (3)
  • (1)
  • (10)
  • (1)
  • (1)
  • (5)
  • (39)
  • (1)
  • (4)
  • (1)
  • (1)
  • (6)
  • (1)
  • (2)
  • (2,873)
  • (8)
  • (1)
  • (62)
  • (2)
  • (9)
  • (1)
  • (1)
  • (1)
  • (2)
  • (2)
  • (8)
  • (5)
  • (1)
  • (16)
  • (1)
  • (2)
  • (28)
  • (262)
  • (1)
  • (3)
  • (2)
  • (17)
  • (1)
  • (1)
  • (10)
  • (10)
  • (2)
  • (1)
  • (2)
  • (40)
  • (7)

special interests

  • (154)
  • (15,255)
  • (166,540)
  • (30)
  • (1,167,302)

Quantity

  • (1)
  • (7)
  • (2)
  • (3,051)
  • (922)
  • (1,918)
  • (4,393)
Show all

Classification

  • (81)
  • (105)
  • (739,844)
  • (3,641)
  • (5)
  • (689,211)
  • (31,508)
Show all

Host Species

  • (564)
  • (2,693)
  • (38)
  • (1)
  • (15)
  • (1,653)
  • (726)
Show all

Conjugate

  • (29,735)
  • (9)
  • (1)
  • (25)
  • (2,863)
  • (74)
  • (89)
Show all

Applications

  • (435)
  • (2)
  • (36)
  • (23)
  • (169)
  • (830)
  • (3)
Show all

Target Species

  • (59)
  • (1)
  • (59)
  • (34)
  • (95)
  • (163)
  • (5)
Show all

Isotype

  • (2)
  • (1)
  • (2)
  • (1)
  • (1)
  • (1)
  • (6)
Show all

Regulatory Status

  • (336)
  • (962)
  • (1,377,924)

Form

  • (2,701)
  • (2,147)
  • (1,630)
  • (14)
  • (9)
  • (21)
  • (300,887)
Show all

Molecular Weight (g/mol)

  • (1)
  • (1)
  • (1)
  • (1)
  • (1)
  • (1)
  • (1)
Show all

Search Within Results
Keyword Search:
1,921 – 1,935 of 1,636,916 results
1,921

Invitrogen™ Luteinizing Hormone Monoclonal Antibody (5304)
GREENER_CHOICE

Mouse Monoclonal Antibody

EDGE
Content And Storage Maintain refrigerated at 2°C to 8°C for up to 6 months. For long term storage store at -20°C
Target Species Human
Host Species Mouse
Conjugate Unconjugated
Applications ELISA,Immunoprecipitation,Radioimmune Assays (RIA)
Form Liquid
Gene Accession No. P01215, P01229
Isotype IgG1
Concentration 1 mg/mL
Antigen Luteinizing Hormone
Gene Symbols Cga, LHB
Regulatory Status RUO
Purification Method Protein A
Gene Alias aGSU; alphaGSU; alpha-GSU; alphaSU; Anterior pituitary glycoprotein hormones common subunit alpha; CGA; Cga1; CG-alpha; CGB4; Choriogonadotropin alpha chain; chorionic gonadotrophin subunit alpha; chorionic gonadotropin, alpha polypeptide; follicle-stimulating hormone alpha chain; follicle-stimulating hormone alpha subunit; follitropin; follitropin alpha chain; FSHA; FSH-alpha; FSH-B; FSH-beta; glycoprotein hormones alpha chain; glycoprotein hormones, alpha polypeptide; glycoprotein hormones, alpha subunit; GPHa; GPHA1; GPHalpha; HCG; HH23; hLHB; interstitial cell stimulating hormone, beta chain; interstitial cell-stimulating hormone; leutenising hormone beta; leutropin; LH; LH alpha 1-1; LH alpha 1-2; LH alpha 1-3; LH alpha 3; LH beta-1; LH beta-2; LH beta-3; LHA; LHB; LH-B; LHbeta; LSH-alpha; LSH-B; LSH-beta; Luteinizing hormone (lutropin) subunit beta; luteinizing hormone alpha chain; luteinizing hormone beta; luteinizing hormone beta polypeptide; luteinizing hormone beta subunit; luteinizing hormone subunit beta; Lutropin alpha chain; lutropin beta chain; Lutropin subunit beta; pituitary hormone alpha subunit; precursor polypeptide; precursor polypeptide (AA -24 to 96); thyroid-stimulating hormone alpha chain; Thyrotropin alpha chain; TSHA; TSH-alpha
Gene LHB
Product Type Antibody
Gene ID (Entrez) 1081, 3972
Formulation PBS with 1mg/mL BSA and 0.05% sodium azide; pH 7.4
Immunogen Human Luteinizing Hormone.
Classification Monoclonal
Primary or Secondary Primary
Clone 5304
1,922

TER-119 Monoclonal Antibody (TER-119), PerCP-Cyanine5.5, eBioscience™, Invitrogen™
GREENER_CHOICE

Rat Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage 4°C, store in dark, DO NOT FREEZE!
Target Species Mouse
Host Species Rat
Conjugate PerCP-Cyanine5.5
Applications Flow Cytometry
Form Liquid
Isotype IgG2b κ
Gene Accession No. 0
Concentration 0.2 mg/mL
Antigen TER-119
Gene Symbols Ly76
Regulatory Status RUO
Purification Method Affinity chromatography
Gene Alias Ly76; Ly-76; TER119
Gene Ly76
Product Type Antibody
Gene ID (Entrez) 104231
Formulation PBS with 0.09% sodium azide; pH 7.2
Classification Monoclonal
Primary or Secondary Primary
Clone TER-119
1,923

Phospho-Histone H2A.X (Ser139) Recombinant Mouse Monoclonal Antibody (CR55T33), Invitrogen™

Mouse Recombinant Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species Human,Mouse
Host Species Mouse
Conjugate Unconjugated
Applications Flow Cytometry,Western Blot
Form Liquid
Isotype IgG1 κ
Gene Accession No. P16104, P27661
Concentration 1.0 mg/mL
Antigen Phospho-Histone H2A.X (Ser139)
Regulatory Status RUO
Purification Method Protein A/G
Gene Alias AW228881; gamma H2AX; gammaH2ax; H2A histone family member X; H2A histone family, member X; H2A.X; H2A.X variant histone; H2A/X; h2afx; H2ax; H2AX histone; Hist5-2ax; histone 5 protein 2ax; histone H2A.x; Histone H2a/x; Histone H2AX; RGD1566119; similar to H2A histone family, member X; zgc:56329
Gene H2AX
Product Type Antibody
Gene ID (Entrez) 15270, 3014
Formulation PBS with 0.09% sodium azide; pH 7.2-7.4
Classification Recombinant Monoclonal
Primary or Secondary Primary
Clone CR55T33
1,924

CD54 (ICAM-1) Monoclonal Antibody (HA58), Alexa Fluor™ 700, eBioscience™, Invitrogen™
GREENER_CHOICE

Mouse Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage 4°C, store in dark, DO NOT FREEZE!
Target Species Human
Host Species Mouse
Conjugate Alexa Fluor 700
Applications Flow Cytometry
Form Liquid
Isotype IgG1 κ
Gene Accession No. P05362
Concentration 5 μL/Test
Antigen CD54 (ICAM-1)
Gene Symbols ICAM1
Regulatory Status RUO
Purification Method Affinity chromatography
Gene Alias BB2; CD54; cell surface glycoprotein P3.58; Human rhinovirus receptor; ICAM; Icam1; ICAM-1; ICAM-1; CD54 homolog; Intercellular adhesion molecule 1; intercellular adhesion molecule 1 (CD54), human rhinovirus receptor; intercellular adhesion molecule-1; intercellular adhesion molecule-1 precursor; Ly 47; Ly-47; major group rhinovirus receptor; MALA2; MALA-2; MyD10; P3.58; sCD54; soluble CD54; Surface antigen of activated B cells
Gene ICAM1
Product Type Antibody
Gene ID (Entrez) 3383
Formulation PBS with BSA and 0.09% sodium azide; pH 7.2
Classification Monoclonal
Primary or Secondary Primary
Clone HA58
1,925

Invitrogen™ H3K4me1 Recombinant Superclonal™ Antibody, ChIP-Verified

Rabbit Recombinant Superclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species Human,Mouse
Host Species Rabbit
Conjugate Unconjugated
Applications Peptide Array,ChIP Assay,ChIP sequencing (ChIP-seq),Western Blot,CUT&RUN,Immunocytochemistry
Form Liquid
Gene Accession No. P68431, P68433, P84228, Q71DI3
Isotype IgG
Concentration 0.5 mg/mL
Antigen H3K4me1
Gene Symbols H3C1, H3C10, H3C12, H3C14, H3C15, H3C2, H3C7
Regulatory Status RUO
Purification Method Protein A
Gene Alias B0035.7; CELE_T10C6.12; CG31613; CG31613-PA; CG33803; CG33806; CG33809; CG33812; CG33815; CG33818; CG33821; CG33824; CG33827; CG33830; CG33833; CG33836; CG33839; CG33842; CG33845; CG33848; CG33851; CG33854; CG33857; CG33860; CG33863; CG33866; Dmel\CG31613; Dmel_CG31613; F07B7.10; F07B7.3; F08G2.2; F17E9.13; F35H10.1; F45F2.4; F54E12.5; F55G1.10; H02I12.7; H3; H3 histone; H3 histone family, member A; H3 histone family, member I; H3 histone family, member K; H3 histone family, member L; H3 histone family, member M; H3 histone, family 2; H3 histone, family 3A; H3 histone, family 3B; H3 histone, family 3B (H3.3B); H3 histone, family 3B.1; H3 histone, family 3C; H3 K4; H3.1-221; H3.1-291; H3.1-I; H3.2; H3.2-221; H3.2-614; H3.2-615; H3.2-616; h3.2a; H3.3A; H3.3B; H3.5; H3/A; H3/b; H3/d; H3/f; H3/i; H3/j; H3/k; H3/l; H3/M; H3/n; H3/o; H3-143; H3-291; H3-3A; H3-3b; h3-5; H3-53; H3-614; H3a; H3b; H3-B; H3c1; H3C10; H3c11; H3C12; H3C2; H3C3; H3C4; H3C6; H3C7; H3c8; H3f; H3-F; H3F1K; H3F2; H3F3; h3f3a; H3F3B; h3f3b.1; H3F3C; h3f3d; H3FA; H3FB; H3FC HIST1H3C; H3FD; H3FF; H3FH; H3FI; H3FJ; H3FK; H3FL; H3FM; H3FN; H3g; H3h; H3i; H3K4; H3K4me; H3Lys4me; H3Lys4me1; h3r; his-12; his-16; his-19; his-21; His3; his-3; His3:CG31613; His3:CG31613-PA; His3:CG33803; His3:CG33806; His3:CG33809; His3:CG33812; His3:CG33815; His3:CG33818; His3:CG33821; His3:CG33824; His3:CG33827; His3:CG33830; His3:CG33833; His3:CG33836; His3:CG33839; His3:CG33842; His3:CG33845; His3:CG33848; His3:CG33851; His3:CG33854; His3:CG33857; His3:CG33860; His3:CG33863; His3:CG33866; his-30; his-33; his-43; his-47; his-51; his-53; his-57; his-61; his-65; his-68; his-7; Hist1; Hist1h3a; Hist1h3b; Hist1h3c; HIST1H3D; Hist1h3e; Hist1h3f; Hist1h3g; hist1h3g.L; Hist1h3h; HIST1H3I; HIST1H3J; hist2h3; HIST2H3A; Hist2h3b; HIST2H3C; Hist2h3c1; Hist2h3c2; Hist2h3c2-ps; Hist2h3ca1; Hist2h3ca2; HIST2H3D; histone 1, H3a; histone 1, H3b; histone 1, H3f; histone 1, H3h; histone 2, H3a; histone 2, H3c; histone 2, H3c2; histone 2, H3ca2; Histone 3; histone cluster 1, H3a; histone cluster 1, H3b; histone cluster 1, H3f; histone cluster 1, H3g protein L homeolog; histone cluster 1, H3h; histone cluster 2, H3a; histone cluster 2, H3c; histone cluster 2, H3c2; histone cluster 2, H3c2, pseudogene; histone gene complex 1; Histone H2A; Histone H3; histone H3.1; Histone H3.2; histone H3.3; Histone H3.3C; histone H3.5; Histone H3/a; Histone H3/b; Histone H3/c; Histone H3/d; Histone H3/f; Histone H3/h; Histone H3/i; Histone H3/j; Histone H3/k; histone H3/l; Histone H3/m; histone H3/o; Histone H3K4me1; histone variant H3.5; hypothetical protein LOC550262; K06C4.11; K06C4.3; M32461; methyl Histone 3; methyl Histone H3; Methyl-H3 K4; Methyl-H3 Lys4; Methyl-Histone H3 K4; Methyl-Histone H3 Lys4; Mono-methyl H3; Mono-methyl Histone H3; PP781; T10C6.12; T23D8.6; wu:fa25h06; wu:fa96g06; wu:fb07a08; wu:fb36f01; XELAEV_18028537mg; zgc:110292; zgc:174300; zgc:56193; zgc:56418; zgc:64222; zgc:86731; ZK131.10; ZK131.6
Gene H3C1
Product Type Antibody
Gene ID (Entrez) 126961, 260423, 319150, 319152, 333932, 360198, 8350, 8356, 8357, 8358, 8968, 97114
Formulation PBS with 0.09% sodium azide; pH 7.2-7.4
Immunogen Methylated peptide (Lys4) corresponding to human Histone H3 (aa 2-11).
Classification Recombinant Superclonal
Primary or Secondary Primary
1,926

CD90.2 (Thy-1.2) Monoclonal Antibody (53-2.1), Biotin, eBioscience™, Invitrogen™
GREENER_CHOICE

Rat Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage 4°C, store in dark, DO NOT FREEZE!
Target Species Mouse
Host Species Rat
Conjugate Biotin
Applications Flow Cytometry
Form Liquid
Isotype IgG2a κ
Gene Accession No. P01831
Concentration 0.5 mg/mL
Antigen CD90.2 (Thy-1.2)
Gene Symbols Thy1
Regulatory Status RUO
Purification Method Affinity chromatography
Gene Alias CD90; FLJ33325; T25; Thy 1.2; Thy1; Thy-1; Thy-1 antigen; thy-1 membrane glycoprotein; Thy1.1; Thy1.2; Thy-1.2; thymus cell antigen 1, theta
Gene Thy1
Product Type Antibody
Gene ID (Entrez) 21838
Formulation PBS with 0.09% sodium azide; pH 7.2
Classification Monoclonal
Primary or Secondary Primary
Clone 53-2.1
1,927

GARP Monoclonal Antibody (YGIC86), Super Bright™ 600, eBioscience™, Invitrogen™

Rat Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage 4°C, store in dark, DO NOT FREEZE!
Target Species Mouse
Host Species Rat
Conjugate Super Bright 600
Applications Flow Cytometry
Form Liquid
Isotype IgG2a κ
Gene Accession No. G3XA59
Concentration 0.2 mg/mL
Antigen GARP
Gene Symbols LRRC32
Regulatory Status RUO
Purification Method Affinity chromatography
Gene Alias AI426318; D11S833E; D11S833Eh; D7H11S833E; EG434215; Garp; garpin; Glycoprotein A repetitions predominant; leucine rich repeat containing 32; leucine-rich repeat-containing protein 32; Lrrc32; Transforming growth factor beta activator LRRC32
Gene LRRC32
Product Type Antibody
Gene ID (Entrez) 434215
Formulation PBS with BSA and 0.09% sodium azide; pH 7.2
Classification Monoclonal
Primary or Secondary Primary
Clone YGIC86
1,928

Invitrogen™ CD8a Monoclonal Antibody (OX8), APC, eBioscience™
GREENER_CHOICE

Mouse Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage 4°C, store in dark, DO NOT FREEZE!
Target Species Rat
Host Species Mouse
Conjugate APC
Applications Flow Cytometry
Form Liquid
Gene Accession No. P05541, P07725
Isotype IgG1 κ
Concentration 0.2 mg/mL
Antigen CD8a
Gene Symbols Cd8a, CD8B
Regulatory Status RUO
Purification Method Affinity chromatography
Gene Alias BB154331; CD8; CD8 alpha; CD8 alpha chain; CD8 alpha chain precursor; CD8 antigen; CD8 antigen 32 kDa chain; CD8 antigen 37 kDa chain; CD8 antigen alpha polypeptide; CD8 antigen alpha protein; CD8 antigen alpha protein precursor; CD8 antigen alpha-chain; CD8 antigen beta polypeptide; CD8 antigen beta polypeptide precursor; CD8 antigen beta-chain; CD8 antigen, alpha chain; CD8 antigen, alpha polypeptide; CD8 antigen, alpha polypeptide (p32); CD8 antigen, alpha-chain; CD8 antigen, beta chain; CD8 antigen, beta chain 1; CD8 antigen, beta polypeptide; CD8 antigen, beta polypeptide 1 (p37); CD8 antigen, beta-chain; CD8 beta; CD8 beta chain; CD8 beta-2; CD8a; CD8A antigen alpha; CD8a molecule; CD8A; T-cell surface glycoprotein; CD8alpha; CD8B; CD8b antigen; CD8b molecule; CD8b molecule pseudogene; Cd8b1; CD8beta; CD8BP; fCD8; LEU2; Leu-2; Leu2 T-lymphocyte antigen; leu-2a; Ly-2; LY3; Ly-3; Ly-35; Ly-B; Ly-C; Lymphocyte antigen 3; Lyt2; Lyt-2; Lyt-2.1 lymphocyte differentiation antigen (AA at 100); Lyt3; Lyt-3; MAL; membrane glycoprotein; membrane protein; OKT8 T-cell antigen; OX-8 membrane antigen; p32; P37; RHACD8-4; T cell co-receptor; T lymphocyte surface glycoprotein beta chain; T8 T-cell antigen; T-cell antigen Leu2; T-cell membrane glycoprotein Ly-3; T-cell surface glycoprotein; T-cell surface glycoprotein CD8 alpha chain; T-cell surface glycoprotein CD8 beta chain; T-cell surface glycoprotein Lyt-2; T-cell surface glycoprotein Lyt-3; T-cell surface molecule; T-lymphocyte differentiation antigen T8/Leu-2; type I transmembrane glycoprotein
Gene CD8B
Product Type Antibody
Gene ID (Entrez) 24930, 24931
Formulation PBS with 0.09% sodium azide; pH 7.2
Classification Monoclonal
Primary or Secondary Primary
Clone OX8
1,929

Invitrogen™ CD244 Monoclonal Antibody (eBioDM244), APC, eBioscience™
GREENER_CHOICE

Mouse Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage 4°C, store in dark, DO NOT FREEZE!
Target Species Human
Host Species Mouse
Conjugate APC
Applications Flow Cytometry
Form Liquid
Gene Accession No. Q9BZW8
Isotype IgG1 κ
Concentration 5 μL/Test
Antigen CD244
Gene Symbols CD244
Regulatory Status RUO
Purification Method Affinity chromatography
Gene Alias 2B4; C9.1; CD244; CD244 long isoform; CD244 molecule; Cd244 molecule, natural killer cell receptor 2B4; CD244 natural killer cell receptor 2B4; CD244 short isoform; F730046O15Rik; h2B4; Ly90; NAIL; natural killer cell receptor 2B4; NK cell activation inducing ligand NAIL; NK cell activation-inducing ligand; NK cell receptor 2B4; NK cell type I receptor protein 2B4; NKR Nmrk; NKR2B4; Nmrk; non MHC restricted killing associated; non-MHC restricted killing associated; Signaling lymphocytic activation molecule 4; SLAM family member 4; SLAMF4; transmembrane NK cell receptor 2B4
Gene CD244
Product Type Antibody
Gene ID (Entrez) 51744
Formulation PBS with BSA and 0.09% sodium azide; pH 7.2
Classification Monoclonal
Primary or Secondary Primary
Clone eBioDM244
1,930

Invitrogen™ KLRG1 Monoclonal Antibody (2F1), Super Bright™ 645, eBioscience™
GREENER_CHOICE

Syrian Hamster Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage 4°C, store in dark, DO NOT FREEZE!
Target Species Mouse
Host Species Syrian Hamster
Conjugate Super Bright 645
Applications Flow Cytometry
Form Liquid
Gene Accession No. O88713
Isotype IgG
Concentration 0.2 mg/mL
Antigen KLRG1
Gene Symbols Klrg1
Regulatory Status RUO
Purification Method Affinity chromatography
Gene Alias 2F1; 2F1-Ag; CLEC15A; C-type lectin domain family 15 member A; C-type lectin domain family 15, member A; ITIM-containing receptor MAFA-L; killer cell lectin like receptor G1; killer cell lectin-like receptor subfamily G member 1; killer cell lectin-like receptor subfamily G, member 1; Klrg1; Mafa; MAFA-2F1; MAFAL; MAFA-L; MAFA-LIKE; MAFA-like receptor; Mast cell function-associated antigen; mast cell function-associated antigen (ITIM-containing); mast cell function-associated antigen 2F1; natural killer cell receptor
Gene Klrg1
Product Type Antibody
Gene ID (Entrez) 50928
Formulation PBS with BSA and 0.09% sodium azide; pH 7.2
Classification Monoclonal
Primary or Secondary Primary
Clone 2F1
1,931

Invitrogen™ SCAMP1 Polyclonal Antibody
GREENER_CHOICE

Rabbit Polyclonal Antibody

EDGE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Target Species Human,Mouse,Rat
Host Species Rabbit
Conjugate Unconjugated
Applications Immunoprecipitation,Western Blot
Form Liquid
Gene Accession No. O15126, P56603, Q8K021
Isotype IgG
Concentration 1 mg/mL
Antigen SCAMP1
Gene Symbols SCAMP1
Regulatory Status RUO
Purification Method Antigen affinity chromatography
Gene Alias 4930505M11Rik; AI415563; AW122395; SCAMP; SCAMP 37; SCAMP1; SCAMP37; Secretory carrier membrane protein 1; secretory carrier-associated membrane protein 1
Gene SCAMP1
Product Type Antibody
Gene ID (Entrez) 107767, 29521, 9522
Formulation PBS with 1mg/mL BSA and 0.05% sodium azide
Immunogen Synthetic Peptide: M(1) S D F D S N P F A D P D L N N P(17) C.
Classification Polyclonal
Primary or Secondary Primary
1,932

Invitrogen™ MHC I Free Chain Monoclonal Antibody (A4), APC, eBioscience™
GREENER_CHOICE

Mouse Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage 4°C, store in dark, DO NOT FREEZE!
Target Species Human
Host Species Mouse
Conjugate APC
Applications Flow Cytometry
Form Liquid
Isotype IgG1 κ
Concentration 5 μL/Test
Antigen MHC I Free Chain
Regulatory Status RUO
Purification Method Affinity chromatography
Gene Alias MHC Free
Product Type Antibody
Formulation PBS with BSA and 0.09% sodium azide; pH 7.2
Classification Monoclonal
Primary or Secondary Primary
Clone A4
1,933

Invitrogen™ ACACB Polyclonal Antibody
GREENER_CHOICE

Rabbit Polyclonal Antibody

EDGE
Content And Storage -20°C
Target Species Human,Mouse,Rat
Host Species Rabbit
Conjugate Unconjugated
Applications Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot
Form Lyophilized
Gene Accession No. E9Q4Z2, O00763
Isotype IgG
Concentration 500 μg/mL
Antigen ACACB
Gene Symbols ACACB
Regulatory Status RUO
Purification Method Affinity chromatography
Gene Alias Acacb; Acc2; ACCB; ACC-beta; acetyl-CoA carboxylase 2; acetyl-CoA carboxylase beta; acetyl-Coenzyme A carboxylase 2; acetyl-Coenzyme A carboxylase beta; AI597064; AW743042; Biotin carboxylase; HACC275
Gene ACACB
Product Type Antibody
Gene ID (Entrez) 100705, 116719, 32
Formulation PBS with 4mg trehalose and 0.05mg sodium azide
Immunogen A synthetic peptide corresponding to a sequence of human Acetyl Coenzyme A Carboxylase/ACACB (EENPEVAVDCVIYLSQHISPAERAQVVHLLSTMD).
Classification Polyclonal
Primary or Secondary Primary
1,934

Cytokeratin 8 Monoclonal Antibody (LP3K), FITC, eBioscience™, Invitrogen™
GREENER_CHOICE

Mouse Monoclonal Antibody

EDGE ENCOMPASS_PREFERRED
Content And Storage 4°C, store in dark, DO NOT FREEZE!
Target Species Human
Host Species Mouse
Conjugate FITC
Form Liquid
Isotype IgG1
Gene Accession No. P05787
Concentration 0.5 mg/mL
Antigen Cytokeratin 8
Gene Symbols KRT8
Regulatory Status RUO
Purification Method Affinity chromatography
Gene KRT8
Product Type Antibody
Gene ID (Entrez) 3856
Classification Monoclonal
Primary or Secondary Primary
Clone LP3K
1,935

Invitrogen™ Syntaxin 6 Recombinant Rabbit Monoclonal Antibody (821L4)

Rabbit Recombinant Monoclonal Antibody

EDGE
Content And Storage Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species Human,Mouse,Rat
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot,Immunocytochemistry
Form Liquid
Gene Accession No. O43752, Q63635, Q9JKK1
Isotype IgG
Concentration 0.5 mg/mL
Antigen Syntaxin 6
Gene Symbols STX6
Regulatory Status RUO
Purification Method Protein A
Gene Alias 2310039E05Rik; 2410005I16Rik; AA437559; AI415714; AI845861; HGNC:11441; STX6; Syn6; syntaxin 6; syntaxin-6
Gene STX6
Product Type Antibody
Gene ID (Entrez) 10228, 58244, 60562
Formulation PBS with 0.09% sodium azide; pH 7.2-7.4
Immunogen Recombinant protein corresponding to Human STX6 (aa 2-234).
Classification Recombinant Monoclonal
Primary or Secondary Primary
Clone 821L4